TBLASTN 2.0.14 [Jun-29-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

RID: 963224602-28106-32245

Query= T25G3.2 CE06511   chitin synthase like (CAMBRIDGE)
TR:Q22791 protein_id:CAA96688.1
         (1380 letters)


Database: GenBank Mouse EST entries
           1,284,374 sequences; 441,526,214 total letters

 
If you have any problems or questions with the results of this search 
please refer to the BLAST FAQs


Taxonomy reports



                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AW124522.1|AW124522  UI-M-BH2.1-apo-g-01-0-UI.s1 NIH_BMAP...    34  8.4

Alignments
>gb|AW124522.1|AW124522 UI-M-BH2.1-apo-g-01-0-UI.s1 NIH_BMAP_M_S3.1 Mus musculus cDNA clone
           UI-M-BH2.1-apo-g-01-0-UI 3'.
          Length = 483

 Score = 33.6 bits (75), Expect = 8.4
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = -1

Query: 426 QSPTCSIARRLARFGLHWVC-DQWFQSARGIASPDFYICLIWLLVGCY-RGWR 476
           Q PT S+ R  A FGLHW    Q  Q+   I + + +  L+++   C  RGWR
Sbjct: 318 QWPTASVLRDAALFGLHWALHSQGAQTYTYIRNKNLFSLLLFVCGKCRPRGWR 160




  Database: GenBank Mouse EST entries
    Posted date:  Jul 9, 2000  8:11 PM
  Number of letters in database: 441,526,214
  Number of sequences in database:  1,284,374
  
Lambda     K      H
   0.326    0.138    0.416 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 707888750
Number of Sequences: 1284374
Number of extensions: 9577293
Number of successful extensions: 61006
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 61006
Number of HSP's gapped (non-prelim): 2
length of query: 1380
length of database: 147,175,404
effective HSP length: 56
effective length of query: 1324
effective length of database: 75,250,460
effective search space: 99631609040
effective search space used: 99631609040
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.7 bits)
S2: 74 (33.2 bits)